Cas no 16941-32-5 (glucagon)
glucagon structure
Product Name:glucagon
CAS No:16941-32-5
MF:C153H225N43O49S
MW:3482.74733328819
MDL:MFCD00167532
CID:50608
PubChem ID:16132283
Update Time:2024-11-01
glucagon Chemical and Physical Properties
Names and Identifiers
-
- glucagon
- Glucagon (1-29) (human, bovine, porcine)
- Glucagon, human recombinant
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH
- Glucagon (1-29) (human, rat, porcine)
- Glucagon Hydrochloride
- Glucagon(1-29)(Human)
- Glucagon(1-29),bovine,human,porcine
- Porcine glucagon
- Gastrin Releasing Peptide, porcine
- Glucagon 1-29
- GLUCAGON 1-37
- GLUCAGON 37
- GLUCAGON ACETATE
- Glucaton
- OXYNTOMODULIN
- OXYNTOMODULIN (PORCINE)
- Glucagon(pig)
- 77: PN: WO0183527 SEQID: 77 claimedsequence
- Bovine glucagon
- Glucagon (Canis familiaris stomach)
- Glucagon(Mesocricetus auratus)
- Glucagon (Saimiri sciureus)
- Glucagon (Xenopus laevis)
- Glucagon (dog pancreas)
- Glucagon (dog)
- Glucagon (human)
- Glucagon (ox)
- Glukagon Novo
- Human glucagon
- 159: PN: WO0069900 SEQID: 338 unclaimedsequence
- 18: PN: WO0039278 SEQID: 24 unclaimed sequence
- 1: PN: WO0053777 SEQID: 1 unclaimed protein
- Glucagon HCl
- Glucagon【dog】
- Glucagon, USP
- 35: PN: WO2006017688 SEQID: 35 unclaimed sequence
- 393:PN: WO2007146038 SEQID: 393 unclaimed protein
- 3: PN: WO2006064378 SEQID: 3unclaimed sequence
- 474: PN: US20080312157 SEQID: 528 unclaimed sequence
- 6: PN:JP2003161732 SEQID: 6 unclaimed sequence
- 84: PN: US20080213898 SEQID: 82 claimed sequence
- 84: PN:WO2008041849 SEQID: 86 claimed protein
- 8: PN: WO2008048607 SEQID: 7 unclaimedsequence
- 10: PN: WO2008036970 FIGURE: 2 unclaimed sequence
- 11: PN: WO2004111078SEQID: 62 unclaimed sequence
- 11: PN: WO2008041849 SEQID: 11 claimed protein
- 121: PN: US20060293232 PAGE: 15 unclaimed sequence
- 148: PN: WO2008033395SEQID: 160 unclaimed sequence
- 15: PN: WO2008022716 SEQID: 18 unclaimed sequence
- 15: PN:WO2008101017 SEQID: 1 claimed protein
- 17: PN: WO2008086086 SEQID: 1 unclaimedprotein
- 1: PN: US20040002442SEQID: 1 unclaimed sequence
- 1:PN: WO2005019261 SEQID: 1 unclaimed sequence
- 1: PN: WO2007056362 SEQID: 1claimed protein
- 1: PN: WO2008062420 SEQID: 1 unclaimed sequence
- 1: PN:WO2009099763 SEQID: 1 unclaimed protein
- 1: PN: WO2009155258 SEQID: 1 claimedprotein
- 2149: PN: WO03060071 SEQID: 2211 unclaimed
- 24: PN: WO2010013012SEQID: 24 unclaimed sequence
- 272: PN: US20090175821 SEQID: 338 claimedprotein
- 2: PN: WO2008076933 SEQID: 8 claimed protein
- 31: PN: WO03071268 PAGE:28 unclaimed sequence
- Glucagon (GLU)
- Glucagon (1-29), bovine, human, porcine
- GLUCAGON (1-37) (PORCINE)
- HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
- H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH
- Glucagon(1-29) Human HCl
- His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr
- Glucagon, porcine, for bioassay
- Glucagonum (INN-Latin)
- Gvoke HypoPen1 mg Auto-Injector
- AKOS040741791
- EINECS 232-708-2
- GVOKE HYPOPEN
- DTXCID701475001
- HG Factor
- GLUCAGON (MART.)
- HG-Factor
- Glukagon
- L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine
- NCGC00167140-01
- GLUCAGON (USP MONOGRAPH)
- Glucagon1555
- glucagon injection, solution
- Gvoke HypoPen0.5 mg Auto-Injector
- Gvoke PFS0.5 mg Pre-filled Syringe
- F85453
- HIS-SER-GLU(NH2)-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TY R-LEU-ASP-SER-ARG-ARG-ALA-GLU(NH2)-ASP-PHE-VAL-GLU(NH2)-TRP-LEU-MET-ASP(NH2)-THR
- NS00078784
- Glucagon, acetate salt, >=97.0% (HPLC)
- Glucagon, porcine, for immunoassay
- Hyperglycemic-Glycogenolytic Factor
- Glucagonum
- Glucagon (USP:INN:BAN:JAN)
- Big plasma glucagon
- Glucagon (pig)
- Gut glucagon-like immunoreactants
- Gvoke PFS1 mg Pre-filled Syringe
- BAQSIMI
- Glucagon-like-immunoreactivity
- Glucagon, porcine
- Human glucagon, European Pharmacopoeia (EP) Reference Standard
- HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
- 9007-92-5
- HSDB 3337
- 16941-32-5
- Glucagone [DCIT]
- L-Threonine, L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-.alpha.-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-.alpha.-aspartyl-L-seryl-L-arginyl-L-argin yl-L-alanyl-L-glutaminyl-L-.alpha.-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-
- Glucagon (swine)
- Glucagon [USP:INN:BAN:JAN]
- L-Threonine, L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glytaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-
- Proglucagon (33-61)
- Gvoke KitVial
- Glucagon (Mesocricetus auratus)
- His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr
- Gvoke PFS
- Glucagon, pig
- GLUCAGON (USP IMPURITY)
- Glucagon (1-29)
- SCHEMBL15268863
- Glucagonum [INN-Latin]
- UNII-76LA80IG2G
- DTXSID101016809
- Gvoke Kit
- Glucagone
- H04AA01
- 76LA80IG2G
-
- MDL: MFCD00167532
- Inchi: 1S/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1
- InChI Key: MASNOZXLGMXCHN-ZLPAWPGGSA-N
- SMILES: C12C=CC=CC=1NC=C2C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@H](C(=O)O)[C@H](O)C)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](NC(=O)[C@H]([C@H](O)C)NC(=O)CNC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1N=CNC=1)CC1C=CC=CC=1)CC1C=CC(O)=CC=1)CC1C=CC(O)=CC=1)CC1C=CC=CC=1
Computed Properties
- Exact Mass: 3480.62000
- Monoisotopic Mass: 3480.615702
- Isotope Atom Count: 0
- Hydrogen Bond Donor Count: 55
- Hydrogen Bond Acceptor Count: 92
- Heavy Atom Count: 246
- Rotatable Bond Count: 143
- Complexity: 8160
- Covalently-Bonded Unit Count: 1
- Defined Atom Stereocenter Count: 31
- Undefined Atom Stereocenter Count : 0
- Defined Bond Stereocenter Count: 0
- Undefined Bond Stereocenter Count: 0
- Topological Polar Surface Area: 1560
- XLogP3: -16.9
Experimental Properties
- Density: 1.53
- Solubility: 幾乎不溶于水和大多數(shù)有機(jī)溶劑。它可溶于稀無機(jī)酸和堿金屬氫氧化物的稀溶液。
- PSA: 1564.04000
- LogP: -0.41090
- Solubility: Soluble to 1 mg/ml in water
glucagon Security Information
- Signal Word:warning
- Hazard Statement: H303May be harmful if swallowed+H313Skin contact may be harmful+H333Inhalation may be harmful to the body
-
Warning Statement:
P264Thoroughly clean after treatment
P280Wear protective gloves/Wear protective clothing/Wear protective goggles/Wear a protective mask
P305If it enters the eyes
P351Rinse carefully with water for a few minutes
P338Remove the contact lens(If any)And easy to operate,Continue flushing
P337If eye irritation persists
P313Obtain medical advice/care - WGK Germany:3
- Safety Instruction: H303May be harmful if swallowed+H313Skin contact may be harmful+H333Inhalation may be harmful to the body
- FLUKA BRAND F CODES:3-10-21
- Storage Condition:Protect from light Powder -80°C 2 years ? -20°C 1 year In solvent -80°C 6 months ? -20°C 1 month
glucagon Pricemore >>
| Related Categories | No. | Product Name | Cas No. | Purity | Specification | Price | update time | Inquiry |
|---|---|---|---|---|---|---|---|---|
| SHANG HAI XIAN DING Biotechnology Co., Ltd. | B-US059-1mg |
glucagon |
16941-32-5 | 99% | 1mg |
1176CNY | 2021-05-07 | |
| SHANG HAI XIAN DING Biotechnology Co., Ltd. | B-US059-5mg |
glucagon |
16941-32-5 | 99% | 5mg |
2677CNY | 2021-05-07 | |
| SHANG HAI XIAN DING Biotechnology Co., Ltd. | B-US059-10mg |
glucagon |
16941-32-5 | 99% | 10mg |
5124CNY | 2021-05-07 | |
| S e l l e c k ZHONG GUO | P1056-50mg |
Glucagon HCl |
16941-32-5 | 99.05% | 50mg |
RMB6142.5 | 2021-06-17 | |
| ChemScence | CS-5936-1mg |
Glucagon (1-29), bovine, human, porcine |
16941-32-5 | 99.81% | 1mg |
$79.0 | 2022-04-27 | |
| ChemScence | CS-5936-5mg |
Glucagon (1-29), bovine, human, porcine |
16941-32-5 | 99.81% | 5mg |
$238.0 | 2022-04-27 | |
| ChemScence | CS-5936-10mg |
Glucagon (1-29), bovine, human, porcine |
16941-32-5 | 99.81% | 10mg |
$370.0 | 2022-04-27 | |
| ChemScence | CS-5936-25mg |
Glucagon (1-29), bovine, human, porcine |
16941-32-5 | 99.81% | 25mg |
$726.0 | 2022-04-27 | |
| ChemScence | CS-5936-50mg |
Glucagon (1-29), bovine, human, porcine |
16941-32-5 | 99.81% | 50mg |
$977.0 | 2022-04-27 | |
| TRC | G282705-10mg |
Glucagon |
16941-32-5 | 10mg |
$1126.00 | 2023-05-18 |
glucagon Suppliers
Amadis Chemical Company Limited
Gold Member
(CAS:16941-32-5)glucagon
Order Number:A938633
Stock Status:in Stock
Quantity:5mg/10mg/25mg/50mg
Purity:99%
Pricing Information Last Updated:Friday, 30 August 2024 15:27
Price ($):226.0/351.0/602.0/853.0
Email:[email protected]
glucagon Related Literature
-
Kaiyuan Huang,Wangkang Qiu,Meilian Ou,Xiaorui Liu,Zenan Liao,Sheng Chu RSC Adv., 2020,10, 18824-18829
-
Quan Xiang,Yiqin Chen,Zhiqin Li,Kaixi Bi,Guanhua Zhang,Huigao Duan Nanoscale, 2016,8, 19541-19550
-
Mark D. Allendorf,Alauddin Ahmed,Tom Autrey,Jeffrey Camp,Eun Seon Cho,Maciej Haranczyk,Abhi Karkamkar,Di-Jia Liu,Katie R. Meihaus,Iffat H. Nayyar,Roman Nazarov,Donald J. Siegel,Vitalie Stavila,Jeffrey J. Urban,Srimukh Prasad Veccham,Brandon C. Wood Energy Environ. Sci., 2018,11, 2784-2812
-
Supaporn Sawadjoon,Joseph S. M. Samec Org. Biomol. Chem., 2011,9, 2548-2554
-
Inês S. Albuquerque,Hélia F. Jeremias,Miguel Chaves-Ferreira,Dijana Matak-Vinkovic,Omar Boutureira,Carlos C. Rom?o Chem. Commun., 2015,51, 3993-3996
Recommended suppliers
Amadis Chemical Company Limited
(CAS:16941-32-5)glucagon
Purity:99%/99%/99%/99%
Quantity:5mg/10mg/25mg/50mg
Price ($):226.0/351.0/602.0/853.0