Cas no 106612-94-6 (GLP-1(7-37))
GLP-1(7-37) Chemical and Physical Properties
Names and Identifiers
-
- Human GLP-1 (7-37)
- 7-37-Glucagon-like peptide I (human)
- Insulinotropin (human)
- Peptide GLP-1 (human glucose-lowering peptide-1)
- GLP-1 (7-37)
- GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)
- GLP-1(7-37) Acetate
- GLP-1,7-37
- GLUCAGON-LIKE PEPTIDE 1 (7-37)
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH
- Tesamorelin Acetate
- Glucagon-Like Peptide 1
- HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY
- HuMan GLP-1
- insulinotropin
- Preproglucagon 78-108
- PREPROGLUCAGON 78-108 HUMAN
- Tglp-1
- Glp-I (7-37)
- GLP-1 (7-37) (HUMAN)
- 7-37-Glucagon-likepeptide
- GLP-1(7-37)
-
- MDL: MFCD00167940
- Inchi: 1S/C151H228N40O47/c1-17-77(10)121(148(236)169-81(14)127(215)177-105(60-87-63-160-92-36-25-24-35-90(87)92)138(226)179-101(56-74(4)5)139(227)188-119(75(6)7)146(234)176-94(37-26-28-52-152)130(218)161-65-111(199)170-93(39-30-54-159-151(156)157)129(217)164-68-118(210)211)190-140(228)103(57-84-31-20-18-21-32-84)180-135(223)99(47-51-116(206)207)175-134(222)95(38-27-29-53-153)172-125(213)79(12)166-124(212)78(11)168-133(221)98(44-48-110(155)198)171-112(200)66-162-132(220)97(46-50-115(204)205)174-136(224)100(55-73(2)3)178-137(225)102(59-86-40-42-89(197)43-41-86)181-143(231)107(69-192)184-145(233)109(71-194)185-147(235)120(76(8)9)189-142(230)106(62-117(208)209)182-144(232)108(70-193)186-150(238)123(83(16)196)191-141(229)104(58-85-33-22-19-23-34-85)183-149(237)122(82(15)195)187-113(201)67-163-131(219)96(45-49-114(202)203)173-126(214)80(13)167-128(216)91(154)61-88-64-158-72-165-88/h18-25,31-36,40-43,63-64,72-83,91,93-109,119-123,160,192-197H,17,26-30,37-39,44-62,65-71,152-154H2,1-16H3,(H2,155,198)(H,158,165)(H,161,218)(H,162,220)(H,163,219)(H,164,217)(H,166,212)(H,167,216)(H,168,221)(H,169,236)(H,170,199)(H,171,200)(H,172,213)(H,173,214)(H,174,224)(H,175,222)(H,176,234)(H,177,215)(H,178,225)(H,179,226)(H,180,223)(H,181,231)(H,182,232)(H,183,237)(H,184,233)(H,185,235)(H,186,238)(H,187,201)(H,188,227)(H,189,230)(H,190,228)(H,191,229)(H,202,203)(H,204,205)(H,206,207)(H,208,209)(H,210,211)(H4,156,157,159)/t77-,78-,79-,80-,81-,82+,83+,91-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,119-,120-,121-,122-,123-/m0/s1
- InChI Key: GCYXWQUSHADNBF-AAEALURTSA-N
- SMILES: O=C([C@H](CC(C)C)NC([C@H](CC1=CNC2C=CC=CC1=2)NC([C@H](C)NC([C@H]([C@@H](C)CC)NC([C@H](CC1C=CC=CC=1)NC([C@H](CCC(=O)O)NC([C@H](CCCCN)NC([C@H](C)NC([C@H](C)NC([C@H](CCC(N)=O)NC(CNC([C@H](CCC(=O)O)NC([C@H](CC(C)C)NC([C@H](CC1C=CC(=CC=1)O)NC([C@H](CO)NC([C@H](CO)NC([C@H](C(C)C)NC([C@H](CC(=O)O)NC([C@H](CO)NC([C@H]([C@@H](C)O)NC([C@H](CC1C=CC=CC=1)NC([C@H]([C@@H](C)O)NC(CNC([C@H](CCC(=O)O)NC([C@H](C)NC([C@H](CC1=CNC=N1)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(=O)O)=O)CCCNC(=N)N)=O)=O)CCCCN)=O)C(C)C
Computed Properties
- Exact Mass: 3353.67000
- Hydrogen Bond Donor Count: 50
- Hydrogen Bond Acceptor Count: 87
- Heavy Atom Count: 238
- Rotatable Bond Count: 141
Experimental Properties
- Water Partition Coefficient: Soluble in water at 2mg/ml
- PSA: 1408.40000
- LogP: 1.43480
GLP-1(7-37) Security Information
- WGK Germany:3
- Safety Instruction: S22; S24/25
- Storage Condition:Powder -80°C 2 years ? -20°C 1 year In solvent -80°C 6 months ? -20°C 1 month
- Safety Term:S22-24/25
GLP-1(7-37) Pricemore >>
| Related Categories | No. | Product Name | Cas No. | Purity | Specification | Price | update time | Inquiry |
|---|---|---|---|---|---|---|---|---|
| ChemScence | CS-5975-1mg |
GLP-1(7-37) |
106612-94-6 | 99.87% | 1mg |
$277.0 | 2022-04-28 | |
| ChemScence | CS-5975-5mg |
GLP-1(7-37) |
106612-94-6 | 99.87% | 5mg |
$475.0 | 2022-04-28 | |
| ChemScence | CS-5975-10mg |
GLP-1(7-37) |
106612-94-6 | 99.87% | 10mg |
$726.0 | 2022-04-28 | |
| ChemScence | CS-5975-25mg |
GLP-1(7-37) |
106612-94-6 | 99.87% | 25mg |
$1188.0 | 2022-04-28 | |
| SHANG HAI MAI KE LIN SHENG HUA Technology Co., Ltd. | G860441-5mg |
GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
106612-94-6 | >98% | 5mg |
¥5,302.80 | 2022-01-14 | |
| WU HAN AN JIE KAI Biomedical Technology Co., Ltd. | ajce44358-1mg |
GLP-1(7-37) |
106612-94-6 | 98% | 1mg |
¥1872.00 | 2022-04-26 | |
| WU HAN AN JIE KAI Biomedical Technology Co., Ltd. | ajce44358-5mg |
GLP-1(7-37) |
106612-94-6 | 98% | 5mg |
¥3209.00 | 2022-04-26 | |
| WU HAN AN JIE KAI Biomedical Technology Co., Ltd. | ajce44358-10mg |
GLP-1(7-37) |
106612-94-6 | 98% | 10mg |
¥4903.00 | 2022-04-26 | |
| WU HAN AN JIE KAI Biomedical Technology Co., Ltd. | ajce44358-25mg |
GLP-1(7-37) |
106612-94-6 | 98% | 25mg |
¥8024.00 | 2022-04-26 | |
| SHANG HAI JI ZHI SHENG HUA Technology Co., Ltd. | H16320-5mg |
GLP-1(7-37) |
106612-94-6 | 99% | 5mg |
¥3598.0 | 2023-09-07 |
GLP-1(7-37) Related Literature
-
Yuki Ishikawa,Tohru Hira,Daisuke Inoue,Yukikazu Harada,Hiroyuki Hashimoto,Mikio Fujii,Motoni Kadowaki,Hiroshi Hara Food Funct. 2015 6 2525
-
Xianli Niu,Shirong Nong,Xiaomin Zhang,Xiangyang Li,Cheng Wang,Wei Li,Tianhong Zhou RSC Adv. 2020 10 4725
-
Christine M. Bruen,Fiona O'Halloran,Kevin D. Cashman,Linda Giblin Food Funct. 2012 3 1131
-
Alba Miguéns-Gómez,Marta Sierra-Cruz,Anna Maria Pérez-Vendrell,Esther Rodríguez-Gallego,Raúl Beltrán-Debón,Ximena Terra,Anna Ardévol,Montserrat Pinent Food Funct. 2022 13 10491
-
àngela Casanova-Martí,Francisca Isabel Bravo,Joan Serrano,Anna Ardévol,Montserrat Pinent,Bego?a Muguerza Food Funct. 2019 10 4062
Additional information on GLP-1(7-37)
GLP-1(7-37) (CAS No. 106612-94-6): An Overview of Its Role in Diabetes Management and Beyond
GLP-1(7-37), with the Chemical Abstracts Service (CAS) number 106612-94-6, is a truncated form of the glucagon-like peptide-1 (GLP-1) hormone. This compound has gained significant attention in recent years due to its pivotal role in the management of type 2 diabetes mellitus (T2DM) and its potential therapeutic applications in other metabolic disorders. GLP-1(7-37) is a 31-amino acid peptide that is derived from the proglucagon gene, which also encodes other important peptides such as glucagon and GLP-2.
The primary function of GLP-1(7-37) is to enhance glucose-dependent insulin secretion, thereby helping to regulate blood glucose levels. This mechanism is particularly beneficial for individuals with T2DM, as it addresses the core issue of impaired insulin secretion and glucose homeostasis. Additionally, GLP-1(7-37) has been shown to have other beneficial effects, including suppression of appetite, reduction of gastric emptying, and improvement of beta-cell function.
Recent research has further elucidated the multifaceted benefits of GLP-1(7-37). A study published in the Journal of Clinical Endocrinology & Metabolism highlighted the role of GLP-1(7-37) in reducing cardiovascular risk factors in patients with T2DM. The study found that treatment with GLP-1 receptor agonists, which include GLP-1(7-37), led to significant improvements in blood pressure, lipid profiles, and markers of inflammation. These findings underscore the potential of GLP-1(7-37) as a comprehensive therapeutic agent for managing not only diabetes but also associated cardiovascular complications.
In addition to its metabolic benefits, GLP-1(7-37) has shown promise in neuroprotective and cognitive enhancement applications. A study published in Nature Communications demonstrated that GLP-1 receptor activation can protect against neurodegeneration and improve cognitive function in animal models of Alzheimer's disease. This opens up new avenues for exploring the use of GLP-1(7-37) in neurological disorders, potentially offering a dual benefit for patients with both metabolic and neurodegenerative conditions.
The pharmacokinetic properties of GLP-1(7-37) are also noteworthy. Due to its short half-life, which is typically around 2 minutes, it is rapidly degraded by dipeptidyl peptidase IV (DPP-IV). However, this rapid degradation can be overcome through the use of DPP-IV inhibitors or by modifying the peptide structure to enhance stability. These advancements have led to the development of long-lasting GLP-1 analogs that can provide sustained therapeutic effects with fewer dosing requirements.
Clinical trials have consistently demonstrated the safety and efficacy of GLP-1(7-37)-based therapies. A meta-analysis published in the Lancet Diabetes & Endocrinology reviewed multiple randomized controlled trials and found that GLP-1 receptor agonists significantly reduced HbA1c levels, body weight, and systolic blood pressure compared to placebo or other antidiabetic agents. These results have solidified the position of GLP-1(7-37) as a first-line treatment option for T2DM management.
Beyond its clinical applications, GLP-1(7-37) has also been a subject of extensive basic research aimed at understanding its molecular mechanisms and signaling pathways. Studies have shown that GLP-1 receptor activation leads to increased intracellular cAMP levels, which subsequently activate protein kinase A (PKA) and other downstream signaling cascades. These pathways are crucial for mediating the insulinotropic and other beneficial effects of GLP-1(7-37).
In conclusion, GLP-1(7-37) (CAS No. 106612-94-6) represents a promising therapeutic agent with a wide range of applications in diabetes management and beyond. Its ability to improve glucose homeostasis, reduce cardiovascular risk factors, and potentially offer neuroprotective benefits makes it a valuable tool in modern medicine. Ongoing research continues to uncover new insights into its mechanisms and potential uses, further solidifying its importance in both clinical practice and scientific inquiry.
106612-94-6 (GLP-1(7-37)) Related Products
- 29705-92-8(L-Arginine,L-phenylalanyl-L-seryl-L-tryptophylglycyl-L-alanyl-L-a-glutamylglycyl-L-glutaminyl-)
- 222018-18-0(L-Prolinamide,N-(1-oxooctadecyl)-L-tyrosylglycyl-L-tyrosyl-L-arginyl-L-leucyl-L-arginyl-L-arginyl-L-lysyl-L-tryptophyl-L-a-glutamyl-L-a-glutamyl-L-lysyl-L-isoleucyl-L-prolyl-L-asparaginyl-(9CI))
- 133514-43-9(Exendin(9-39) amide)
- 9001-63-2(Lysozyme)
- 150238-87-2(Proadrenomedullin (1-20) (human))
- 1218-34-4(N-Acetyl-L-tryptophan)
- 35115-60-7(L-Proline,5-oxo-L-prolyl-L-tryptophyl-L-prolyl-L-arginyl-L-prolyl-L-glutaminyl-L-isoleucyl-L-prolyl-)
- 275371-94-3(Taspoglutide)
- 192387-38-5(Neuropeptide AF (human))
- 51827-01-1(Xenopsin)