Cas no 60675-77-6 (Big Gastrin I Human)
Big Gastrin I Human Chemical and Physical Properties
Names and Identifiers
-
- Big Gastrin I Human
- Human gastrin-34 I
- 5-Oxo-L-prolyl-L-leucylglycyl-L-prolyl-L-glutaminylglycyl-L-prolyl-L-prolyl-L-histidyl-L-leucyl-L-valyl-L-alanyl-L-alpha-aspartyl-L-prolyl-L-seryl-L-lysyl-L-lysyl-L-glutaminylglycyl-L-prolyl-L-tryptophyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-tyrosylglycyl-L-tryptophyl-L-methionyl-L-alpha-aspartyl-L-phenylalaninamide
- BIG GASTRIN - 1, HUMAN
- BIG GASTRIN I HUMAN SYNTHETIC
- Gastrin-34
- GLP-LEU-GLY-PRO-GLN-GLY-PRO-PRO-HIS-LEU-VAL-ALA-ASP-PRO-SER-LYS-LYS-GLN-GLY-PRO-TRP-LEU-GLU-GLU-GLU-GLU-GLU-ALA-TYR-GLY-TRP-MET-ASP-PHE-NH2: GLP-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
- GREGORY STRUCTURE
- GT-1,HUMAN
- HG-34
- PYR-LEU-GLY-PRO-GLN-GLY-PRO-PRO-HIS-LEU-VAL-ALA-ASP-PRO-SER-LYS-LYS-GLN-GLY-PRO-TRP-LEU-GLU-GLU-GLU-GLU-GLU-ALA-TYR-GLY-TRP-MET-ASP-PHE-NH2
- PYR-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
- BIG GASTRIN-1 HUMAN
- BIG GASTRIN (HUMAN) AMMONIUM
- BIG GASTRIN I (HUMAN)
- GT-1, HUMAN
- Glp-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2
- PGLU-LEU-GLY-PRO-GLN-GLY-PRO-PRO-HIS-LEU-VAL-ALA-ASP-PRO-SER-LYS-LYS-GLN-GLY-PRO-TRP-LEU-GLU-GLU-GLU-GLU-GLU-ALA-TYR-GLY-TRP-MET-ASP-PHE-NH2
-
- Inchi: 1S/C176H251N43O53S/c1-89(2)70-117(206-157(253)109-47-55-134(224)192-109)152(248)188-85-137(227)215-64-23-36-127(215)170(266)203-108(46-54-133(180)223)151(247)187-86-138(228)217-66-27-40-131(217)176(272)219-68-26-39-130(219)172(268)211-123(77-99-82-182-88-189-99)166(262)208-119(72-91(5)6)168(264)214-146(92(7)8)174(270)191-94(10)149(245)212-125(79-145(241)242)175(271)218-67-25-38-129(218)173(269)213-126(87-220)169(265)195-106(35-20-22-63-178)155(251)194-105(34-19-21-62-177)156(252)196-107(45-53-132(179)222)150(246)186-84-136(226)216-65-24-37-128(216)171(267)210-122(76-98-81-184-104-33-18-16-31-102(98)104)165(261)207-118(71-90(3)4)163(259)201-114(52-60-143(237)238)161(257)200-113(51-59-142(235)236)160(256)199-112(50-58-141(233)234)159(255)198-111(49-57-140(231)232)158(254)197-110(48-56-139(229)230)154(250)190-93(9)148(244)205-120(74-96-41-43-100(221)44-42-96)153(249)185-83-135(225)193-121(75-97-80-183-103-32-17-15-30-101(97)103)164(260)202-115(61-69-273-11)162(258)209-124(78-144(239)240)167(263)204-116(147(181)243)73-95-28-13-12-14-29-95/h12-18,28-33,41-44,80-82,88-94,99,105-131,146,183-184,220-221H,19-27,34-40,45-79,83-87,177-178H2,1-11H3,(H2,179,222)(H2,180,223)(H2,181,243)(H,185,249)(H,186,246)(H,187,247)(H,188,248)(H,190,250)(H,191,270)(H,192,224)(H,193,225)(H,194,251)(H,195,265)(H,196,252)(H,197,254)(H,198,255)(H,199,256)(H,200,257)(H,201,259)(H,202,260)(H,203,266)(H,204,263)(H,205,244)(H,206,253)(H,207,261)(H,208,262)(H,209,258)(H,210,267)(H,211,268)(H,212,245)(H,213,269)(H,214,264)(H,229,230)(H,231,232)(H,233,234)(H,235,236)(H,237,238)(H,239,240)(H,241,242)/t93-,94-,99?,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,146-/m0/s1
- InChI Key: WMHXQWGLTYWEFZ-FEDFGZKZSA-N
- SMILES: C(N)(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC1C2C(=CC=CC=2)NC=1)NC(=O)CNC(=O)[C@H](CC1C=CC(O)=CC=1)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1C2C(=CC=CC=2)NC=1)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1N=CN=C1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCC(=O)N1
Computed Properties
- Exact Mass: 3846.80000
Experimental Properties
- Color/Form: White freeze-dried powder. A polypeptide hormone composed of 34 amino acid residues, which is an active polypeptide produced by the pyloric vestibular mucosa at the bottom of the stomach. After secretion, it enters the blood, stimulates the upper part of the stomach, and causes acid secretion of gastric parietal cells. In addition to ethnic differences, gastrin also has different polypeptide chain lengths, which can be divided into big gastrin \ small gastrin and minigastrin. Macrogastrin is a 34 peptide, and the human structure is shown above, The structural changes of pigs are as follows
- PSA: 1509.92000
- LogP: 2.29380
- Solubility: Not determined
Big Gastrin I Human Pricemore >>
| Related Categories | No. | Product Name | Cas No. | Purity | Specification | Price | update time | Inquiry |
|---|---|---|---|---|---|---|---|---|
| A2B Chem LLC | AJ12867-1mg |
Big Gastrin I (human) |
60675-77-6 | 1mg |
$489.00 | 2024-04-19 | ||
| A2B Chem LLC | AJ12867-5mg |
Big Gastrin I (human) |
60675-77-6 | 5mg |
$1265.00 | 2024-04-19 | ||
| A2B Chem LLC | AJ12867-10mg |
Big Gastrin I (human) |
60675-77-6 | 10mg |
$2042.00 | 2024-04-19 | ||
| AAPPTec | P001298-1mg |
Big Gastrin-1, human |
60675-77-6 | 1mg |
$330.00 | 2025-04-29 | ||
| AAPPTec | P001298-5mg |
Big Gastrin-1, human |
60675-77-6 | 5mg |
$990.00 | 2025-04-29 | ||
| AAPPTec | P001298-10mg |
Big Gastrin-1, human |
60675-77-6 | 10mg |
$1.650.00 | 2025-04-29 |
Big Gastrin I Human Related Literature
-
Lei Yang,Yuan Zeng,Haibo Wu,Chunwu Zhou,Lei Tao J. Mater. Chem. B, 2020,8, 1383-1388
-
Eunhak Lim,Jiyoung Heo,Seong Keun Kim Nanoscale, 2019,11, 11369-11378
-
Zhonghua Xiang,Chuanqi Fang,Sanhua Leng,Dapeng Cao J. Mater. Chem. A, 2014,2, 7662-7665
-
R. M. Pemberton,J. P. Hart,T. T. Mottram Analyst, 2001,126, 1866-1871
Additional information on Big Gastrin I Human
Comprehensive Analysis of Big Gastrin I Human (CAS No. 60675-77-6): Structure, Function, and Research Applications
Big Gastrin I Human (CAS No. 60675-77-6) is a biologically active peptide hormone that plays a pivotal role in gastrointestinal physiology. As a larger molecular form of gastrin, it consists of 34 amino acids and is primarily produced by G-cells in the gastric antrum and duodenum. This peptide has garnered significant attention in recent years due to its diagnostic and therapeutic potential, particularly in conditions like Zollinger-Ellison syndrome and gastric acid hypersecretion disorders.
The structural uniqueness of Big Gastrin I Human lies in its extended N-terminus compared to other gastrin forms, such as Gastrin-17. This molecular characteristic enhances its stability in circulation, making it a valuable biomarker for clinical assays. Researchers frequently investigate its receptor binding affinity and signal transduction mechanisms, especially concerning the cholecystokinin B receptor (CCKBR), which mediates its physiological effects.
In the era of personalized medicine, the study of Big Gastrin I Human has gained momentum. Cutting-edge techniques like mass spectrometry-based proteomics and ELISA kits have enabled precise quantification in patient samples. Recent publications highlight its emerging role in tumor microenvironment modulation, with particular relevance to gastroenteropancreatic neuroendocrine tumors (GEP-NETs). These findings align with growing public interest in early cancer biomarkers and non-invasive diagnostic tools.
From a pharmaceutical perspective, 60675-77-6 serves as a reference standard in drug development pipelines targeting acid-related disorders. Its synthetic analogs are being explored for their potential in peptide-based therapeutics, a hot topic in biopharmaceutical forums. The compound's stability profile also makes it suitable for long-term stability studies, addressing industry demands for robust quality control protocols.
The research community continues to investigate Big Gastrin I Human's interactions with proton pump inhibitors (PPIs), responding to widespread patient concerns about long-term PPI use side effects. Studies utilizing radioimmunoassay techniques have provided insights into its pharmacokinetics, while molecular docking simulations explore potential therapeutic interventions. These approaches resonate with current searches for natural alternatives to acid suppressants and gut hormone balance strategies.
In diagnostic laboratories, 60675-77-6 is crucial for calibrating equipment to measure fasting serum gastrin levels – a common test for evaluating gastric endocrine function. The compound's high purity (>95%) ensures reliable results in automated immunoassay systems, addressing healthcare providers' needs for accurate hormonal assessments. This application has become particularly relevant with increasing cases of autoimmune gastritis and atrophic gastritis worldwide.
Emerging trends in nutrigenomics have also spotlighted Big Gastrin I Human, as dietary components can influence its secretion patterns. Researchers are examining how probiotic interventions and micronutrient supplementation might modulate gastrin physiology, topics frequently searched by health-conscious consumers. These investigations bridge the gap between basic science and functional nutrition applications.
From a technical standpoint, handling Big Gastrin I Human requires strict adherence to cold chain protocols due to its peptide nature. Best practices include storage at -20°C in lyophilized form and reconstitution with sterile phosphate-buffered saline. Such handling guidelines are critical for maintaining bioactivity, especially in cell culture experiments and animal model studies of gastric function.
The commercial availability of 60675-77-6 from multiple GMP-certified manufacturers ensures consistent supply for research institutions. Quality parameters like endotoxin levels and HPLC purity profiles are rigorously controlled, meeting the demands of translational research programs. This reliability supports ongoing investigations into gastrin's pleiotropic effects beyond acid secretion, including its potential roles in mucosal repair and epithelial cell proliferation.
As the scientific community delves deeper into gut-brain axis interactions, Big Gastrin I Human has emerged as a molecule of interest in neurogastroenterology. Preliminary data suggest possible connections between gastrin isoforms and enteric nervous system function, aligning with popular searches about gut health and mental wellbeing. These multidisciplinary approaches demonstrate how traditional gastrointestinal hormones are gaining new relevance in holistic health research paradigms.
60675-77-6 (Big Gastrin I Human) Related Products
- 16395-57-6((S)-5-Oxopyrrolidine-2-carboxamide)
- 16395-58-7(N-Acetyl-L-prolinamide)
- 102767-28-2(Levetiracetam)
- 33996-58-6(Etiracetam)
- 332062-08-5(Fmoc-S-3-amino-4,4-diphenyl-butyric acid)
- 1270529-38-8(1,2,3,4,5,6-Hexahydro-[2,3]bipyridinyl-6-ol)
- 2680771-01-9(4-cyclopentyl-3-{(prop-2-en-1-yloxy)carbonylamino}butanoic acid)
- 2098070-20-1(2-(3-(Pyridin-3-yl)-1H-pyrazol-1-yl)acetimidamide)
- 1444113-98-7(N-(3-cyanothiolan-3-yl)-2-[(2,2,2-trifluoroethyl)sulfanyl]pyridine-4-carboxamide)
- 941977-17-9(N'-(3-chloro-2-methylphenyl)-N-2-(dimethylamino)-2-(naphthalen-1-yl)ethylethanediamide)